PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_43.86
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 184aa    MW: 21125.6 Da    PI: 9.8772
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_43.86genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.88.1e-32103161159
                                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                  ldDgy+WrKYGqK+vk++++prsYYrCt++gC+vkk+++r ++d+ +v++tYeg H h+
  evm.model.supercontig_43.86 103 LDDGYRWRKYGQKPVKNNKYPRSYYRCTHKGCNVKKQIQRLTKDEGIVVTTYEGIHSHQ 161
                                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.6E-3388162IPR003657WRKY domain
SuperFamilySSF1182908.76E-2995162IPR003657WRKY domain
PROSITE profilePS5081129.51698163IPR003657WRKY domain
SMARTSM007742.2E-36103162IPR003657WRKY domain
PfamPF031063.3E-25104161IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MDKYSTVVFS GSTSSSNVVM NSFNEFKVTR STGNGFLGLD HDRQDLMINS VYGDDRIKIH  60
GGSATNYNSC STEGKAEGKK KEEDKKMKKQ RYAFQTRSRV DILDDGYRWR KYGQKPVKNN  120
KYPRSYYRCT HKGCNVKKQI QRLTKDEGIV VTTYEGIHSH QIQNSTDNFE HILTQMQIYT  180
SFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-2793163777Probable WRKY transcription factor 4
2lex_A1e-2793163777Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437986.12e-65hypothetical protein CICLE_v10032816mg
RefseqXP_006484154.12e-65PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA26e-56WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLV4TN362e-65V4TN36_9R
STRINGPOPTR_0003s16750.13e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.12e-56WRKY DNA-binding protein 75